PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_37790
Common NameKK1_036664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 292aa    MW: 33202 Da    PI: 6.37
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_37790genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l + + ++G g+W++++ + g+ R +k+c++rw +yl
    C.cajan_37790 15 KGLWSPEEDNKLRNHILKYGHGCWSSVPIKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding53.46e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E++ ++ ++++lG++ W+ Ia++++ gRt++++k++w++yl
    C.cajan_37790  68 RGVFSKHEEDTILALHHMLGNK-WSQIAQHLP-GRTDNEIKNYWHSYL 113
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-22865IPR009057Homeodomain-like
PROSITE profilePS5129416.6051062IPR017930Myb domain
SuperFamilySSF466892.4E-2813109IPR009057Homeodomain-like
SMARTSM007175.9E-111464IPR001005SANT/Myb domain
PfamPF002496.7E-131562IPR001005SANT/Myb domain
CDDcd001678.06E-101862No hitNo description
PROSITE profilePS5129425.22463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2566118IPR009057Homeodomain-like
SMARTSM007176.9E-1667115IPR001005SANT/Myb domain
PfamPF002492.3E-1568113IPR001005SANT/Myb domain
CDDcd001677.54E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MECQPPEKAK PKYRKGLWSP EEDNKLRNHI LKYGHGCWSS VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGV FSKHEEDTIL ALHHMLGNKW SQIAQHLPGR TDNEIKNYWH SYLKKKLIKA  120
KEMECDKQNQ YASSSSDTMD NSLSPQKLAT QDPSYALLEN MDKSIEHSDN FFSQSYNFSK  180
EACQSSLPKL LFSEWLSMDN VNGGSGSSVN SDDSLVLGNE FDQNSTFQDA VMHMLEENFV  240
EEYHNTLIHS STTTEVYNSD IKSSNQEDGS DFIHCIPGAD LCSNFSLTNG AM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-241111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548192.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K46e-62LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A151RHB70.0A0A151RHB7_CAJCA; Transcription factor LAF1
STRINGGLYMA16G31280.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.12e-62myb domain protein 45